General Information

  • ID:  hor004767
  • Uniprot ID:  P12272
  • Protein name:  osteostatin
  • Gene name:  PTHLH
  • Organism:  Homo sapiens (Human)
  • Family:  Parathyroid hormone family
  • Source:  Human
  • Expression:  Ubiquitous. Also expressed in the mammary gland.
  • Disease:  Diseases associated with PTHLH include Brachydactyly, Type E2 and Brachydactyly, Type E1.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001501 skeletal system development; GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007565 female pregnancy; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0008544 epidermis development; GO:0010468 regulation of gene expression; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation; GO:0032331 negative regulation of chondrocyte differentiation; GO:0046058 cAMP metabolic process; GO:0061182 negative regulation of chondrocyte development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005654 nucleoplasm; GO:0005737 cytoplasm; GO:0005794 Golgi apparatus; GO:0005829 cytosol

Sequence Information

  • Sequence:  ETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKK
  • Length:  33
  • Propeptide:  MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
  • Signal peptide:  MQRRLVQQWSVAVFLLSYAVPSCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Osteostatin is a potent inhibitor of osteoclastic bone resorption.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:  Q03431
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12272-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004767_AF2.pdbhor004767_ESM.pdb

Physical Information

Mass: 444045 Formula: C170H295N51O51
Absent amino acids: ACDFHIMSW Common amino acids: K
pI: 10.82 Basic residues: 13
Polar residues: 8 Hydrophobic residues: 2
Hydrophobicity: -244.55 Boman Index: -12936
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 20.61
Instability Index: 2782.12 Extinction Coefficient cystines: 1490
Absorbance 280nm: 46.56

Literature

  • PubMed ID:  NA
  • Title:  NA